Lineage for d5gpig_ (5gpi G:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3039002Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)
  4. 3039003Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) (S)
    Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex
  5. 3039016Family g.96.1.0: automated matches [324385] (1 protein)
    not a true family
  6. 3039017Protein automated matches [324386] (3 species)
    not a true protein
  7. 3039028Species Zika virus [TaxId:64320] [327137] (14 PDB entries)
  8. 3039036Domain d5gpig_: 5gpi G: [327152]
    Other proteins in same PDB: d5gpib_, d5gpid_, d5gpif_, d5gpih_
    automated match to d2ggva_

Details for d5gpig_

PDB Entry: 5gpi (more details), 1.58 Å

PDB Description: crystal structures of unlinked ns2b-ns3 protease from zika virus and its complex with a reverse peptide inhibitor
PDB Compounds: (G:) NS2B cofactor

SCOPe Domain Sequences for d5gpig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gpig_ g.96.1.0 (G:) automated matches {Zika virus [TaxId: 64320]}
dmyieragditwekdaevtgnsprldvaldesgdfslvee

SCOPe Domain Coordinates for d5gpig_:

Click to download the PDB-style file with coordinates for d5gpig_.
(The format of our PDB-style files is described here.)

Timeline for d5gpig_: