Lineage for d1rhd_1 (1rhd 1-149)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24082Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
  4. 24083Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (2 families) (S)
  5. 24094Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (2 proteins)
  6. 24095Protein Rhodanese [52828] (1 species)
  7. 24096Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries)
  8. 24109Domain d1rhd_1: 1rhd 1-149 [32715]

Details for d1rhd_1

PDB Entry: 1rhd (more details), 2.5 Å

PDB Description: structure of bovine liver rhodanese. i. structure determination at 2.5 angstroms resolution and a comparison of the conformation and sequence of its two domains

SCOP Domain Sequences for d1rhd_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhd_1 c.46.1.2 (1-149) Rhodanese {Cow (Bos taurus)}
vhqvlyralvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdi
eecrdkaspyevmlpseagfadyvgslgisndthvvvyngddlgsfyaprvwwmfrvfgh
rtvsvlnggfrnwlkeghpvtsepsrpep

SCOP Domain Coordinates for d1rhd_1:

Click to download the PDB-style file with coordinates for d1rhd_1.
(The format of our PDB-style files is described here.)

Timeline for d1rhd_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rhd_2