SCOPe 2.06: Domain d1boha2: 1boh A:150-293

Lineage for d1boha2 (1boh A:150-293)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Rhodanese [52828] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries)

8. Domain d1boha2: 1boh A:150-293 [32714]

Details for d1boha2

PDB Entry: 1boh, 2.3 Å

PDB Description: sulfur-substituted rhodanese (orthorhombic form)

PDB Compounds: (A:) rhodanese

SCOPe Domain Sequences for d1boha2:

Sequence; same for both SEQRES and ATOM records:

>d1boha2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]}
aifkatlnrsllktyeqvlenleskrfqlvdsraqgrylgtqpepdavgldsghirgsvn
mpfmnfltedgfekspeelramfeakkvdltkpliatcrkgvtachialaaylcgkpdva
iydgswfewfhrappetwvsqgkg

Timeline for d1boha2:

• d1boha2 first appeared (with stable ids) in SCOP 1.55, called d1boh_2
  
• d1boha2 appears in SCOPe 2.05
  
• d1boha2 appears in SCOPe 2.07
  
• d1boha2 appears in the current release, SCOPe 2.08