SCOP 1.59: Domain d1boh_2: 1boh 150-293

Lineage for d1boh_2 (1boh 150-293)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (3 families)

5. Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (2 proteins)

6. Protein Rhodanese [52828] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries)

8. Domain d1boh_2: 1boh 150-293 [32714]

Details for d1boh_2

PDB Entry: 1boh, 2.3 Å

PDB Description: sulfur-substituted rhodanese (orthorhombic form)

SCOP Domain Sequences for d1boh_2:

Sequence; same for both SEQRES and ATOM records:

>d1boh_2 c.46.1.2 (150-293) Rhodanese {Cow (Bos taurus)}
aifkatlnrsllktyeqvlenleskrfqlvdsraqgrylgtqpepdavgldsghirgsvn
mpfmnfltedgfekspeelramfeakkvdltkpliatcrkgvtachialaaylcgkpdva
iydgswfewfhrappetwvsqgkg

Timeline for d1boh_2:

• d1boh_2 first appeared (with stable ids) in SCOP 1.55
  
• d1boh_2 appears in SCOP 1.57
  
• d1boh_2 appears in SCOP 1.61
  
• d1boh_2 appears in the current release, SCOPe 2.08, called d1boha2