SCOPe 2.06: Domain d5gpid_: 5gpi D:

Lineage for d5gpid_ (5gpi D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (6 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [327129] (2 PDB entries)

8. Domain d5gpid_: 5gpi D: [327131]
   Other proteins in same PDB: d5gpia_, d5gpic_, d5gpie_, d5gpig_
   automated match to d3e90b_

Details for d5gpid_

PDB Entry: 5gpi, 1.58 Å

PDB Description: crystal structures of unlinked ns2b-ns3 protease from zika virus and its complex with a reverse peptide inhibitor

PDB Compounds: (D:) NS3 protease

SCOPe Domain Sequences for d5gpid_:

Sequence, based on SEQRES records:

>d5gpid_ b.47.1.3 (D:) automated matches {Zika virus [TaxId: 64320]}
ttdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdlv
sycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgs
pildkcgrviglygngvvikngsyvsaitqgkr

Sequence, based on observed residues (ATOM records):

>d5gpid_ b.47.1.3 (D:) automated matches {Zika virus [TaxId: 64320]}
ttdgvyrvmtstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdlvsycgp
wkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgspildk
cgrviglygngvvikngsyvsaitqgkr

Timeline for d5gpid_:

• d5gpid_ is new in SCOPe 2.06-stable
  
• d5gpid_ appears in SCOPe 2.07
  
• d5gpid_ appears in the current release, SCOPe 2.08