Lineage for d5gpif_ (5gpi F:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066379Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2066469Protein automated matches [190658] (6 species)
    not a true protein
  7. 2066541Species Zika virus [TaxId:64320] [327129] (2 PDB entries)
  8. 2066544Domain d5gpif_: 5gpi F: [327130]
    Other proteins in same PDB: d5gpia_, d5gpic_, d5gpie_, d5gpig_
    automated match to d3e90b_

Details for d5gpif_

PDB Entry: 5gpi (more details), 1.58 Å

PDB Description: crystal structures of unlinked ns2b-ns3 protease from zika virus and its complex with a reverse peptide inhibitor
PDB Compounds: (F:) NS3 protease

SCOPe Domain Sequences for d5gpif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gpif_ b.47.1.3 (F:) automated matches {Zika virus [TaxId: 64320]}
tdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdlvs
ycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgsp
ildkcgrviglygngvvikngsyvsaitqgkr

SCOPe Domain Coordinates for d5gpif_:

Click to download the PDB-style file with coordinates for d5gpif_.
(The format of our PDB-style files is described here.)

Timeline for d5gpif_: