| Class b: All beta proteins [48724] (177 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
| Protein automated matches [190658] (6 species) not a true protein |
| Species Zika virus [TaxId:64320] [327129] (2 PDB entries) |
| Domain d5gpif_: 5gpi F: [327130] Other proteins in same PDB: d5gpia_, d5gpic_, d5gpie_, d5gpig_ automated match to d3e90b_ |
PDB Entry: 5gpi (more details), 1.58 Å
SCOPe Domain Sequences for d5gpif_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gpif_ b.47.1.3 (F:) automated matches {Zika virus [TaxId: 64320]}
tdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdlvs
ycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgsp
ildkcgrviglygngvvikngsyvsaitqgkr
Timeline for d5gpif_: