SCOPe 2.08: Domain d5fcsh2: 5fcs H:117-239

Lineage for d5fcsh2 (5fcs H:117-239)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5fcsh2: 5fcs H:117-239 [327125]
   automated match to d3juya1
   complexed with so4

Details for d5fcsh2

PDB Entry: 5fcs, 2.01 Å

PDB Description: diabody

PDB Compounds: (H:) diabody

SCOPe Domain Sequences for d5fcsh2:

Sequence; same for both SEQRES and ATOM records:

>d5fcsh2 b.1.1.0 (H:117-239) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggevqlvqsgaevkkpgasvkvsckasgytftsygiswvrqapgqglewmgwisayngnt
nyaqklqgrvtmttdtststaymelrslrsddtavyycatidtasafdiwgqgtmvtvss
ggc

Timeline for d5fcsh2:

• d5fcsh2 first appeared in SCOPe 2.06
  
• d5fcsh2 appears in SCOPe 2.07