![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
![]() | Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) ![]() Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
![]() | Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (5 proteins) duplication: consists of two domains of this fold |
![]() | Protein Rhodanese [52828] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries) |
![]() | Domain d1orba2: 1orb A:150-293 [32712] complexed with act |
PDB Entry: 1orb (more details), 2 Å
SCOPe Domain Sequences for d1orba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orba2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} aifkatlnrsllktyeqvlenleskrfqlvdsraqgrylgtqpepdavgldsghirgsvn mpfmnfltedgfekspeelramfeakkvdltkpliatcrkgvtachialaaylcgkpdva iydgswfewfhrappetwvsqgkg
Timeline for d1orba2: