Lineage for d1orb_1 (1orb 1-149)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244733Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 244734Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (3 families) (S)
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 244748Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (2 proteins)
    duplication: consists of two domains of this fold
  6. 244749Protein Rhodanese [52828] (1 species)
  7. 244750Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries)
  8. 244761Domain d1orb_1: 1orb 1-149 [32711]

Details for d1orb_1

PDB Entry: 1orb (more details), 2 Å

PDB Description: active site structural features for chemically modified forms of rhodanese

SCOP Domain Sequences for d1orb_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orb_1 c.46.1.2 (1-149) Rhodanese {Cow (Bos taurus)}
vhqvlyralvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdi
eecrdkaspyevmlpseagfadyvgslgisndthvvvydgddlgsfyaprvwwmfrvfgh
rtvsvlnggfrnwlkeghpvtsepsrpep

SCOP Domain Coordinates for d1orb_1:

Click to download the PDB-style file with coordinates for d1orb_1.
(The format of our PDB-style files is described here.)

Timeline for d1orb_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1orb_2