SCOPe 2.08: Domain d5ltqj1: 5ltq J:2-219

Lineage for d5ltqj1 (5ltq J:2-219)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (26 species)
   not a true protein

7. Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [227942] (7 PDB entries)

8. Domain d5ltqj1: 5ltq J:2-219 [327102]
   Other proteins in same PDB: d5ltqa2, d5ltqb2, d5ltqc2, d5ltqd2, d5ltqf2, d5ltqj2, d5ltql2, d5ltqn2, d5ltqp2
   automated match to d4jgea_
   complexed with cl

Details for d5ltqj1

PDB Entry: 5ltq, 2.05 Å

PDB Description: structure of the yellow fluorescent protein lanyfp from branchiostoma lanceolatum at ph 7.5

PDB Compounds: (J:) Green fluorescent protein blFP-Y3

SCOPe Domain Sequences for d5ltqj1:

Sequence; same for both SEQRES and ATOM records:

>d5ltqj1 d.22.1.0 (J:2-219) automated matches {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
slpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygf
hqylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtg
fpadgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpm
aanilknqpmfvfrktelkhsktelnfkewqkaftdvm

Timeline for d5ltqj1:

• d5ltqj1 first appeared in SCOPe 2.06
  
• d5ltqj1 appears in SCOPe 2.07