Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (3 families) the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (3 proteins) duplication: consists of two domains of this fold |
Protein Rhodanese [52828] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries) |
Domain d1boi_2: 1boi 150-293 [32710] |
PDB Entry: 1boi (more details), 2.2 Å
SCOP Domain Sequences for d1boi_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1boi_2 c.46.1.2 (150-293) Rhodanese {Cow (Bos taurus)} aifkatlnrsllktyeqvlenleskrfqlvdsraqgrylgtqpepdavgldsghirgsvn mpfmnfltedgfekspeelramfeakkvdltkpliatcrkgvtachialaaylcgkpdva iydgswfewfhrappetwvsqgkg
Timeline for d1boi_2: