Lineage for d1boi_2 (1boi 150-293)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395764Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 395765Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (3 families) (S)
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 395779Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (3 proteins)
    duplication: consists of two domains of this fold
  6. 395789Protein Rhodanese [52828] (1 species)
  7. 395790Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries)
  8. 395796Domain d1boi_2: 1boi 150-293 [32710]

Details for d1boi_2

PDB Entry: 1boi (more details), 2.2 Å

PDB Description: n-terminally truncated rhodanese

SCOP Domain Sequences for d1boi_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1boi_2 c.46.1.2 (150-293) Rhodanese {Cow (Bos taurus)}
aifkatlnrsllktyeqvlenleskrfqlvdsraqgrylgtqpepdavgldsghirgsvn
mpfmnfltedgfekspeelramfeakkvdltkpliatcrkgvtachialaaylcgkpdva
iydgswfewfhrappetwvsqgkg

SCOP Domain Coordinates for d1boi_2:

Click to download the PDB-style file with coordinates for d1boi_2.
(The format of our PDB-style files is described here.)

Timeline for d1boi_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1boi_1