Lineage for d5mera1 (5mer A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937696Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
    Uniprot P01892 25-298
  8. 2937780Domain d5mera1: 5mer A:1-181 [327098]
    Other proteins in same PDB: d5mera2, d5merb1, d5merb2, d5merd2, d5mere1, d5mere2
    automated match to d1ogaa2
    complexed with ca, edo, gol, mes, so4

Details for d5mera1

PDB Entry: 5mer (more details), 1.88 Å

PDB Description: human leukocyte antigen a02 presenting ilakflhel
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d5mera1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mera1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d5mera1:

Click to download the PDB-style file with coordinates for d5mera1.
(The format of our PDB-style files is described here.)

Timeline for d5mera1: