![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
![]() | Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) ![]() Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
![]() | Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins) duplication: consists of two domains of this fold |
![]() | Protein Rhodanese [52828] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries) |
![]() | Domain d1boia1: 1boi A:8-149 [32709] |
PDB Entry: 1boi (more details), 2.2 Å
SCOPe Domain Sequences for d1boia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1boia1 c.46.1.2 (A:8-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} alvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdieecrdka spyevmlpseagfadyvgslgisndthvvvydgddlgsfyaprvwwmfrvfghrtvsvln ggfrnwlkeghpvtsepsrpep
Timeline for d1boia1: