SCOP 1.59: Domain d1boi_1: 1boi 8-149

Lineage for d1boi_1 (1boi 8-149)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (3 families)

5. Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (2 proteins)

6. Protein Rhodanese [52828] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries)

8. Domain d1boi_1: 1boi 8-149 [32709]

Details for d1boi_1

PDB Entry: 1boi, 2.2 Å

PDB Description: n-terminally truncated rhodanese

SCOP Domain Sequences for d1boi_1:

Sequence; same for both SEQRES and ATOM records:

>d1boi_1 c.46.1.2 (8-149) Rhodanese {Cow (Bos taurus)}
alvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdieecrdka
spyevmlpseagfadyvgslgisndthvvvydgddlgsfyaprvwwmfrvfghrtvsvln
ggfrnwlkeghpvtsepsrpep

Timeline for d1boi_1:

• d1boi_1 first appeared (with stable ids) in SCOP 1.55
  
• d1boi_1 appears in SCOP 1.57
  
• d1boi_1 appears in SCOP 1.61
  
• d1boi_1 appears in the current release, SCOPe 2.08, called d1boia1