![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (195 species) not a true protein |
![]() | Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [186776] (13 PDB entries) |
![]() | Domain d5f06b1: 5f06 B:2-81 [327085] Other proteins in same PDB: d5f06a2, d5f06b2 automated match to d1aw9a2 complexed with gsh, so4 |
PDB Entry: 5f06 (more details), 1.8 Å
SCOPe Domain Sequences for d5f06b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f06b1 c.47.1.0 (B:2-81) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]} vlklygapmstctsrvltclheknldfelvpvdlfagehkqppflaknpfgqipaleedd ltlfesraitsyiaekfkgt
Timeline for d5f06b1: