![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
![]() | Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (3 families) ![]() the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
![]() | Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (3 proteins) duplication: consists of two domains of this fold |
![]() | Protein Rhodanese [52828] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries) |
![]() | Domain d2ora_2: 2ora 150-293 [32708] |
PDB Entry: 2ora (more details), 2 Å
SCOP Domain Sequences for d2ora_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ora_2 c.46.1.2 (150-293) Rhodanese {Cow (Bos taurus)} aifkatlnrsllktyeqvlenleskrfqlvdsraqgrylgtqpepdavgldsghirgsvn mpfmnfltedgfekspeelramfeakkvdltkpliatcrkgvtachialaaylcgkpdva iydgswfewfhrappetwvsqgkg
Timeline for d2ora_2: