![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
![]() | Domain d5laxc2: 5lax C:82-180 [327079] Other proteins in same PDB: d5laxa1, d5laxa3, d5laxb1, d5laxb2, d5laxb3, d5laxc1, d5laxd1, d5laxd2, d5laxd3 automated match to d1ieaa1 complexed with mla |
PDB Entry: 5lax (more details), 2.6 Å
SCOPe Domain Sequences for d5laxc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5laxc2 b.1.1.0 (C:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwef
Timeline for d5laxc2: