Lineage for d5laxc2 (5lax C:82-180)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758417Domain d5laxc2: 5lax C:82-180 [327079]
    Other proteins in same PDB: d5laxa1, d5laxa3, d5laxb1, d5laxb2, d5laxb3, d5laxc1, d5laxd1, d5laxd2, d5laxd3
    automated match to d1ieaa1
    complexed with mla

Details for d5laxc2

PDB Entry: 5lax (more details), 2.6 Å

PDB Description: crystal structure of hla_drb1*04:01 in complex with alpha-enolase peptide 26-40
PDB Compounds: (C:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d5laxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5laxc2 b.1.1.0 (C:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

SCOPe Domain Coordinates for d5laxc2:

Click to download the PDB-style file with coordinates for d5laxc2.
(The format of our PDB-style files is described here.)

Timeline for d5laxc2: