SCOPe 2.06: Domain d5laxc1: 5lax C:2-81

Lineage for d5laxc1 (5lax C:2-81)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)

8. Domain d5laxc1: 5lax C:2-81 [327078]
   Other proteins in same PDB: d5laxa2, d5laxa3, d5laxb1, d5laxb2, d5laxb3, d5laxc2, d5laxd1, d5laxd2, d5laxd3
   automated match to d1fnga2
   complexed with mla

Details for d5laxc1

PDB Entry: 5lax, 2.6 Å

PDB Description: crystal structure of hla_drb1*04:01 in complex with alpha-enolase peptide 26-40

PDB Compounds: (C:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d5laxc1:

Sequence; same for both SEQRES and ATOM records:

>d5laxc1 d.19.1.0 (C:2-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala
niavdkanleimtkrsnytp

Timeline for d5laxc1:

• d5laxc1 is new in SCOPe 2.06-stable
  
• d5laxc1 appears in SCOPe 2.07
  
• d5laxc1 appears in the current release, SCOPe 2.08