Lineage for d5laxc1 (5lax C:2-81)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2183623Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2183624Protein automated matches [226842] (4 species)
    not a true protein
  7. 2183637Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)
  8. 2183736Domain d5laxc1: 5lax C:2-81 [327078]
    Other proteins in same PDB: d5laxa2, d5laxa3, d5laxb1, d5laxb2, d5laxb3, d5laxc2, d5laxd1, d5laxd2, d5laxd3
    automated match to d1fnga2
    complexed with mla

Details for d5laxc1

PDB Entry: 5lax (more details), 2.6 Å

PDB Description: crystal structure of hla_drb1*04:01 in complex with alpha-enolase peptide 26-40
PDB Compounds: (C:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d5laxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5laxc1 d.19.1.0 (C:2-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala
niavdkanleimtkrsnytp

SCOPe Domain Coordinates for d5laxc1:

Click to download the PDB-style file with coordinates for d5laxc1.
(The format of our PDB-style files is described here.)

Timeline for d5laxc1: