| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [326861] (11 PDB entries) |
| Domain d5f05d2: 5f05 D:83-213 [327059] Other proteins in same PDB: d5f05a1, d5f05b1, d5f05c1, d5f05d1 automated match to d1aw9a1 complexed with 12p, gol, gsh, mg, pg4, pge |
PDB Entry: 5f05 (more details), 1.7 Å
SCOPe Domain Sequences for d5f05d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f05d2 a.45.1.0 (D:83-213) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
gtqlgaagngyatilvwqeveshqfdpsasklvweqvfkpvfglptdaalvaetevtlgk
vldvyearlsqskylasdsftladlhhlpniqallgtpskklfdsrphvsawvasitgrp
awgkvlallpk
Timeline for d5f05d2: