| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [186776] (13 PDB entries) |
| Domain d5f05d1: 5f05 D:3-82 [327058] Other proteins in same PDB: d5f05a2, d5f05b2, d5f05c2, d5f05d2 automated match to d1aw9a2 complexed with 12p, gol, gsh, mg, pg4, pge |
PDB Entry: 5f05 (more details), 1.7 Å
SCOPe Domain Sequences for d5f05d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f05d1 c.47.1.0 (D:3-82) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
plklhgsvlstntqrvlatlyekevefelvnvnlgagehkqephislnpfgqvpaavdgd
lklfesraisqyvahqyask
Timeline for d5f05d1: