SCOPe 2.08: Domain d5f05d1: 5f05 D:3-82

Lineage for d5f05d1 (5f05 D:3-82)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [186776] (13 PDB entries)

8. Domain d5f05d1: 5f05 D:3-82 [327058]
   Other proteins in same PDB: d5f05a2, d5f05b2, d5f05c2, d5f05d2
   automated match to d1aw9a2
   complexed with 12p, gol, gsh, mg, pg4, pge

Details for d5f05d1

PDB Entry: 5f05, 1.7 Å

PDB Description: crystal structure of glutathione transferase f5 from populus trichocarpa

PDB Compounds: (D:) Phi class glutathione transferase GSTF5

SCOPe Domain Sequences for d5f05d1:

Sequence; same for both SEQRES and ATOM records:

>d5f05d1 c.47.1.0 (D:3-82) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
plklhgsvlstntqrvlatlyekevefelvnvnlgagehkqephislnpfgqvpaavdgd
lklfesraisqyvahqyask

Timeline for d5f05d1:

• d5f05d1 first appeared in SCOPe 2.06
  
• d5f05d1 appears in SCOPe 2.07