SCOPe 2.08: Domain d5f6fa1: 5f6f A:2-139

Lineage for d5f6fa1 (5f6f A:2-139)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [193082] (9 PDB entries)

8. Domain d5f6fa1: 5f6f A:2-139 [327057]
   Other proteins in same PDB: d5f6fa2, d5f6fb2
   automated match to d4llla_
   mutant

Details for d5f6fa1

PDB Entry: 5f6f, 1.75 Å

PDB Description: s. aureus mepr g34r mutant

PDB Compounds: (A:) MarR family regulatory protein

SCOPe Domain Sequences for d5f6fa1:

Sequence; same for both SEQRES and ATOM records:

>d5f6fa1 a.4.5.0 (A:2-139) automated matches {Staphylococcus aureus [TaxId: 1280]}
eftysylfrmishemkqkadqkleqfditneqrhtlgylyahqqdgltqndiakalqrtg
ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse
eeneqmkanltkmlsslq

Timeline for d5f6fa1:

• d5f6fa1 first appeared in SCOPe 2.06
  
• d5f6fa1 appears in SCOPe 2.07