Lineage for d5ltqc1 (5ltq C:2-219)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940637Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [227942] (7 PDB entries)
  8. 2940657Domain d5ltqc1: 5ltq C:2-219 [327053]
    Other proteins in same PDB: d5ltqa2, d5ltqb2, d5ltqc2, d5ltqd2, d5ltqf2, d5ltqj2, d5ltql2, d5ltqn2, d5ltqp2
    automated match to d4jgea_
    complexed with cl

Details for d5ltqc1

PDB Entry: 5ltq (more details), 2.05 Å

PDB Description: structure of the yellow fluorescent protein lanyfp from branchiostoma lanceolatum at ph 7.5
PDB Compounds: (C:) Green fluorescent protein blFP-Y3

SCOPe Domain Sequences for d5ltqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ltqc1 d.22.1.0 (C:2-219) automated matches {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
slpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygf
hqylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtg
fpadgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpm
aanilknqpmfvfrktelkhsktelnfkewqkaftdvm

SCOPe Domain Coordinates for d5ltqc1:

Click to download the PDB-style file with coordinates for d5ltqc1.
(The format of our PDB-style files is described here.)

Timeline for d5ltqc1: