SCOPe 2.06: Domain d1dp2a1: 1dp2 A:1-149

Lineage for d1dp2a1 (1dp2 A:1-149)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Rhodanese [52828] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries)

8. Domain d1dp2a1: 1dp2 A:1-149 [32705]
   complex with lipoate
   complexed with lpb

Details for d1dp2a1

PDB Entry: 1dp2, 2.01 Å

PDB Description: crystal structure of the complex between rhodanese and lipoate

PDB Compounds: (A:) rhodanese

SCOPe Domain Sequences for d1dp2a1:

Sequence; same for both SEQRES and ATOM records:

>d1dp2a1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]}
vhqvlyralvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdi
eecrdkaspyevmlpseagfadyvgslgisndthvvvydgddlgsfyaprvwwmfrvfgh
rtvsvlnggfrnwlkeghpvtsepsrpep

Timeline for d1dp2a1:

• d1dp2a1 first appeared (with stable ids) in SCOP 1.55
  
• d1dp2a1 appears in SCOPe 2.05
  
• d1dp2a1 appears in SCOPe 2.07
  
• d1dp2a1 appears in the current release, SCOPe 2.08