Lineage for d1dp2a1 (1dp2 A:1-149)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (2 families) 
Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (2 proteins) Protein Rhodanese [52828] (1 species) Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries) 
Domain d1dp2a1: 1dp2 A:1-149 [32705]
Details for d1dp2a1
PDB Entry: 1dp2 (more details), 2.01 Å
PDB Description: crystal structure of the complex between rhodanese and lipoate
SCOP Domain Sequences for d1dp2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dp2a1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus)}
vhqvlyralvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdi
eecrdkaspyevmlpseagfadyvgslgisndthvvvydgddlgsfyaprvwwmfrvfgh
rtvsvlnggfrnwlkeghpvtsepsrpep
SCOP Domain Coordinates for d1dp2a1:
Click to download the PDB-style file with coordinates for d1dp2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dp2a1:
- d1dp2a1 appears in SCOP 1.57
- d1dp2a1 appears in the current release, SCOPe 2.08
View in 3D
