| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Clostridium sp. [TaxId:1506] [326919] (2 PDB entries) |
| Domain d5g4lb1: 5g4l B:1-264 [327043] Other proteins in same PDB: d5g4la2, d5g4lb2 automated match to d3i3of_ complexed with ndp |
PDB Entry: 5g4l (more details), 1.8 Å
SCOPe Domain Sequences for d5g4lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g4lb1 c.2.1.0 (B:1-264) automated matches {Clostridium sp. [TaxId: 1506]}
mvnvkkefvdnmfsvkgkvalvtgatgalgcvlskaygyagakvfmtgrnekklqaleae
fkaegidcaygvadpadeaqvdamitacvaqygevnilavthgfnkpqnileqsvadwqy
imdadcksvyvvckyvaqqmvdqgkggkivvvtsqrskrgmagytgyctskggadlmvss
macdlsakyginvnsicptvfrsdltewmfdpesavyqnflkrepigrlaepedfvgyal
flssdasnyitgancdcsggyltc
Timeline for d5g4lb1: