Lineage for d1rhs_2 (1rhs 150-293)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123140Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
  4. 123141Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (3 families) (S)
  5. 123155Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (2 proteins)
  6. 123156Protein Rhodanese [52828] (1 species)
  7. 123157Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries)
  8. 123159Domain d1rhs_2: 1rhs 150-293 [32704]

Details for d1rhs_2

PDB Entry: 1rhs (more details), 1.36 Å

PDB Description: sulfur-substituted rhodanese

SCOP Domain Sequences for d1rhs_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhs_2 c.46.1.2 (150-293) Rhodanese {Cow (Bos taurus)}
aifkatlnrsllktyeqvlenleskrfqlvdsraqgrylgtqpepdavgldsghirgsvn
mpfmnfltedgfekspeelramfeakkvdltkpliatcrkgvtachialaaylcgkpdva
iydgswfewfhrappetwvsqgkg

SCOP Domain Coordinates for d1rhs_2:

Click to download the PDB-style file with coordinates for d1rhs_2.
(The format of our PDB-style files is described here.)

Timeline for d1rhs_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rhs_1