Lineage for d1rhs_2 (1rhs 150-293)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (2 families) 
Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (2 proteins) Protein Rhodanese [52828] (1 species) Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries) 
Domain d1rhs_2: 1rhs 150-293 [32704]
Details for d1rhs_2
PDB Entry: 1rhs (more details), 1.36 Å
PDB Description: sulfur-substituted rhodanese
SCOP Domain Sequences for d1rhs_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rhs_2 c.46.1.2 (150-293) Rhodanese {Cow (Bos taurus)}
aifkatlnrsllktyeqvlenleskrfqlvdsraqgrylgtqpepdavgldsghirgsvn
mpfmnfltedgfekspeelramfeakkvdltkpliatcrkgvtachialaaylcgkpdva
iydgswfewfhrappetwvsqgkg
SCOP Domain Coordinates for d1rhs_2:
Click to download the PDB-style file with coordinates for d1rhs_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rhs_2:
- d1rhs_2 first appeared (with stable ids) in SCOP 1.55
- d1rhs_2 appears in SCOP 1.59
- d1rhs_2 appears in the current release, SCOPe 2.08, called d1rhsa2
View in 3D
