SCOPe 2.08: Domain d5mepd2: 5mep D:182-276

Lineage for d5mepd2 (5mep D:182-276)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d5mepd2: 5mep D:182-276 [327034]
   Other proteins in same PDB: d5mepa1, d5mepb1, d5mepb2, d5mepd1, d5mepe1, d5mepe2
   automated match to d1ogaa1
   complexed with edo, so4

Details for d5mepd2

PDB Entry: 5mep, 2.71 Å

PDB Description: human leukocyte antigen a02 presenting ilgkflhwl

PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d5mepd2:

Sequence; same for both SEQRES and ATOM records:

>d5mepd2 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep

Timeline for d5mepd2:

• d5mepd2 first appeared in SCOPe 2.06
  
• d5mepd2 appears in SCOPe 2.07