Lineage for d5mepd1 (5mep D:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2544763Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (103 PDB entries)
    Uniprot P01892 25-298
  8. 2544924Domain d5mepd1: 5mep D:1-181 [327033]
    Other proteins in same PDB: d5mepa2, d5mepb1, d5mepb2, d5mepd2, d5mepe1, d5mepe2
    automated match to d1ogaa2
    complexed with edo, so4

Details for d5mepd1

PDB Entry: 5mep (more details), 2.71 Å

PDB Description: human leukocyte antigen a02 presenting ilgkflhwl
PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d5mepd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mepd1 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d5mepd1:

Click to download the PDB-style file with coordinates for d5mepd1.
(The format of our PDB-style files is described here.)

Timeline for d5mepd1: