Lineage for d5g4ka_ (5g4k A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846598Species Clostridium sp. [TaxId:1506] [326919] (2 PDB entries)
  8. 2846599Domain d5g4ka_: 5g4k A: [327030]
    automated match to d3i3of_

Details for d5g4ka_

PDB Entry: 5g4k (more details), 1.74 Å

PDB Description: phloroglucinol reductase from clostridium sp. apo-form
PDB Compounds: (A:) Oxidoreductase, short chain dehydrogenase/reductase family protein

SCOPe Domain Sequences for d5g4ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g4ka_ c.2.1.0 (A:) automated matches {Clostridium sp. [TaxId: 1506]}
mvnvkkefvdnmfsvkgkvalvtgatgalgcvlskaygyagakvfmtgrnekklqaleae
fkaegidcaygvadpadeaqvdamitacvaqygevnilavthgfnkpqnileqsvadwqy
imdtdcksvyvvckyvaqqmvdqgkggkivvvtsqrskrgmagytgyctskggadlmvss
macdlsakyginvnsicptvfrsdltewmfdpesavyqnflkrepigrlaepedfvgyal
flssdasnyitgancdcsggyltc

SCOPe Domain Coordinates for d5g4ka_:

Click to download the PDB-style file with coordinates for d5g4ka_.
(The format of our PDB-style files is described here.)

Timeline for d5g4ka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5g4kb_