| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Clostridium sp. [TaxId:1506] [326919] (2 PDB entries) |
| Domain d5g4ka_: 5g4k A: [327030] automated match to d3i3of_ |
PDB Entry: 5g4k (more details), 1.74 Å
SCOPe Domain Sequences for d5g4ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g4ka_ c.2.1.0 (A:) automated matches {Clostridium sp. [TaxId: 1506]}
mvnvkkefvdnmfsvkgkvalvtgatgalgcvlskaygyagakvfmtgrnekklqaleae
fkaegidcaygvadpadeaqvdamitacvaqygevnilavthgfnkpqnileqsvadwqy
imdtdcksvyvvckyvaqqmvdqgkggkivvvtsqrskrgmagytgyctskggadlmvss
macdlsakyginvnsicptvfrsdltewmfdpesavyqnflkrepigrlaepedfvgyal
flssdasnyitgancdcsggyltc
Timeline for d5g4ka_: