SCOPe 2.08: Domain d5dala1: 5dal A:0-76

Lineage for d5dala1 (5dal A:0-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (64 PDB entries)

8. Domain d5dala1: 5dal A:0-76 [327028]
   Other proteins in same PDB: d5dala2, d5dalb2
   automated match to d13gsa2
   complexed with 5au, gsh, mes, pa0, so4

Details for d5dala1

PDB Entry: 5dal, 1.5 Å

PDB Description: crystal structure of human glutathione transferase pi complexed with a metalloid in the presence of glutathione

PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d5dala1:

Sequence; same for both SEQRES and ATOM records:

>d5dala1 c.47.1.5 (A:0-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
ltlyqsntilrhlgrtl

Timeline for d5dala1:

• d5dala1 first appeared in SCOPe 2.06
  
• d5dala1 appears in SCOPe 2.07