Lineage for d5laxb2 (5lax B:93-190)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747484Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2747492Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (43 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 2747544Domain d5laxb2: 5lax B:93-190 [327023]
    Other proteins in same PDB: d5laxa1, d5laxa2, d5laxa3, d5laxb1, d5laxb3, d5laxc1, d5laxc2, d5laxd1, d5laxd3
    automated match to d1sebb1
    complexed with mla

Details for d5laxb2

PDB Entry: 5lax (more details), 2.6 Å

PDB Description: crystal structure of hla_drb1*04:01 in complex with alpha-enolase peptide 26-40
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-4 beta chain

SCOPe Domain Sequences for d5laxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5laxb2 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsltspltvewra

SCOPe Domain Coordinates for d5laxb2:

Click to download the PDB-style file with coordinates for d5laxb2.
(The format of our PDB-style files is described here.)

Timeline for d5laxb2: