SCOPe 2.07: Domain d5laxb2: 5lax B:93-190

Lineage for d5laxb2 (5lax B:93-190)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (43 PDB entries)
   Uniprot P04229 30-219
   probably orthologous to the mouse I-E group

8. Domain d5laxb2: 5lax B:93-190 [327023]
   Other proteins in same PDB: d5laxa1, d5laxa2, d5laxa3, d5laxb1, d5laxb3, d5laxc1, d5laxc2, d5laxd1, d5laxd3
   automated match to d1sebb1
   complexed with mla

Details for d5laxb2

PDB Entry: 5lax, 2.6 Å

PDB Description: crystal structure of hla_drb1*04:01 in complex with alpha-enolase peptide 26-40

PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-4 beta chain

SCOPe Domain Sequences for d5laxb2:

Sequence; same for both SEQRES and ATOM records:

>d5laxb2 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsltspltvewra

Timeline for d5laxb2:

• d5laxb2 first appeared in SCOPe 2.06