Lineage for d5laxb1 (5lax B:1-92)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2183369Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2183379Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (18 PDB entries)
  8. 2183406Domain d5laxb1: 5lax B:1-92 [327022]
    Other proteins in same PDB: d5laxa1, d5laxa2, d5laxa3, d5laxb2, d5laxb3, d5laxc1, d5laxc2, d5laxd2, d5laxd3
    automated match to d1klub2
    complexed with mla

Details for d5laxb1

PDB Entry: 5lax (more details), 2.6 Å

PDB Description: crystal structure of hla_drb1*04:01 in complex with alpha-enolase peptide 26-40
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-4 beta chain

SCOPe Domain Sequences for d5laxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5laxb1 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
gdtrprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaey
wnsqkdlleqkraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d5laxb1:

Click to download the PDB-style file with coordinates for d5laxb1.
(The format of our PDB-style files is described here.)

Timeline for d5laxb1: