Lineage for d1cwta_ (1cwt A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876007Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2876008Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 2876009Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (5 proteins)
  6. 2876013Protein CDC25b [52825] (1 species)
  7. 2876014Species Human (Homo sapiens) [TaxId:9606] [52826] (14 PDB entries)
  8. 2876025Domain d1cwta_: 1cwt A: [32702]
    complexed with cl, mmc, so4

Details for d1cwta_

PDB Entry: 1cwt (more details), 2.3 Å

PDB Description: human cdc25b catalytic domain with methyl mercury
PDB Compounds: (A:) cdc25 b-type tyrosine phosphatase

SCOPe Domain Sequences for d1cwta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwta_ c.46.1.1 (A:) CDC25b {Human (Homo sapiens) [TaxId: 9606]}
dhreligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeye
gghiktavnlplerdaesfllkspiapcsldkrvilifhcefssergprmcrfirerdra
vndypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrswa

SCOPe Domain Coordinates for d1cwta_:

Click to download the PDB-style file with coordinates for d1cwta_.
(The format of our PDB-style files is described here.)

Timeline for d1cwta_: