![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Homo sapiens/mus [TaxId:1383439] [326991] (2 PDB entries) |
![]() | Domain d5i76a2: 5i76 A:107-213 [327018] Other proteins in same PDB: d5i76a1, d5i76b_, d5i76c1, d5i76d_ automated match to d1dn0a2 |
PDB Entry: 5i76 (more details), 1.92 Å
SCOPe Domain Sequences for d5i76a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i76a2 b.1.1.2 (A:107-213) automated matches {Homo sapiens/mus [TaxId: 1383439]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrga
Timeline for d5i76a2:
![]() Domains from other chains: (mouse over for more information) d5i76b_, d5i76c1, d5i76c2, d5i76d_ |