SCOPe 2.08: Domain d5i76a1: 5i76 A:1-106

Lineage for d5i76a1 (5i76 A:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Homo sapiens/mus [TaxId:1383439] [326989] (2 PDB entries)

8. Domain d5i76a1: 5i76 A:1-106 [327017]
   Other proteins in same PDB: d5i76a2, d5i76c2
   automated match to d1dn0a1

Details for d5i76a1

PDB Entry: 5i76, 1.92 Å

PDB Description: crystal structure of fm318, a recombinant fab adopted from cetuximab

PDB Compounds: (A:) FM318_light_chain

SCOPe Domain Sequences for d5i76a1:

Sequence; same for both SEQRES and ATOM records:

>d5i76a1 b.1.1.0 (A:1-106) automated matches {Homo sapiens/mus [TaxId: 1383439]}
dilltqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklel

Timeline for d5i76a1:

• d5i76a1 first appeared in SCOPe 2.06
  
• d5i76a1 appears in SCOPe 2.07