Lineage for d5m62b1 (5m62 B:194-327)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608590Species Mouse (Mus musculus) [TaxId:10090] [187331] (29 PDB entries)
  8. 2608605Domain d5m62b1: 5m62 B:194-327 [327008]
    Other proteins in same PDB: d5m62a2, d5m62b2
    automated match to d4cajb_
    complexed with bgc, ca, glc, gol, p6g

Details for d5m62b1

PDB Entry: 5m62 (more details), 1.7 Å

PDB Description: structure of the mus musclus langerin carbohydrate recognition domain in complex with glucose
PDB Compounds: (B:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d5m62b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m62b1 d.169.1.0 (B:194-327) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ilemvargwkyfsgnfyyfsrtpktwysaeqfcisrkahltsvsseseqkflykaadgip
hwigltkagsegdwywvdqtsfnkeqsrrfwipgepnnagnnehcanirvsalkswndgp
cdntflfickrpyv

SCOPe Domain Coordinates for d5m62b1:

Click to download the PDB-style file with coordinates for d5m62b1.
(The format of our PDB-style files is described here.)

Timeline for d5m62b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5m62b2