SCOPe 2.08: Domain d5i76c2: 5i76 C:107-213

Lineage for d5i76c2 (5i76 C:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Homo sapiens/mus [TaxId:1383439] [326991] (2 PDB entries)

8. Domain d5i76c2: 5i76 C:107-213 [326992]
   Other proteins in same PDB: d5i76a1, d5i76b_, d5i76c1, d5i76d_
   automated match to d1dn0a2

Details for d5i76c2

PDB Entry: 5i76, 1.92 Å

PDB Description: crystal structure of fm318, a recombinant fab adopted from cetuximab

PDB Compounds: (C:) FM318_light_chain

SCOPe Domain Sequences for d5i76c2:

Sequence; same for both SEQRES and ATOM records:

>d5i76c2 b.1.1.2 (C:107-213) automated matches {Homo sapiens/mus [TaxId: 1383439]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrga

Timeline for d5i76c2:

• d5i76c2 first appeared in SCOPe 2.06
  
• d5i76c2 appears in SCOPe 2.07