Lineage for d1qb0a_ (1qb0 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (2 families) 
Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (2 proteins) Protein CDC25b [52825] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52826] (4 PDB entries) 
Domain d1qb0a_: 1qb0 A: [32699]
Details for d1qb0a_
PDB Entry: 1qb0 (more details), 1.91 Å
PDB Description: human cdc25b catalytic domain
SCOP Domain Sequences for d1qb0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qb0a_ c.46.1.1 (A:) CDC25b {Human (Homo sapiens)}
dhreligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeye
gghiktavnlplerdaesfllkspiapcsldkrvilifhcefssergprmcrfirerdra
vndypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrswa
SCOP Domain Coordinates for d1qb0a_:
Click to download the PDB-style file with coordinates for d1qb0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qb0a_:
- d1qb0a_ appears in SCOP 1.57
- d1qb0a_ appears in the current release, SCOPe 2.08
View in 3D