SCOPe 2.08: Domain d5gjtl2: 5gjt L:107-212

Lineage for d5gjtl2 (5gjt L:107-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5gjtl2: 5gjt L:107-212 [326987]
   Other proteins in same PDB: d5gjta1, d5gjta2, d5gjtb_, d5gjth1, d5gjth2, d5gjtl1
   automated match to d1dn0a2

Details for d5gjtl2

PDB Entry: 5gjt, 3.1 Å

PDB Description: crystal structure of h1 hemagglutinin from a/washington/05/2011 in complex with a neutralizing antibody 3e1

PDB Compounds: (L:) light chain of human neutralizing antibody 3E1

SCOPe Domain Sequences for d5gjtl2:

Sequence, based on SEQRES records:

>d5gjtl2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Sequence, based on observed residues (ATOM records):

>d5gjtl2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltskadyekhkvyacevthqglsspvtksfnrg

Timeline for d5gjtl2:

• d5gjtl2 first appeared in SCOPe 2.06
  
• d5gjtl2 appears in SCOPe 2.07