SCOPe 2.07: Domain d5gjtl1: 5gjt L:1-106

Lineage for d5gjtl1 (5gjt L:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d5gjtl1: 5gjt L:1-106 [326986]
   Other proteins in same PDB: d5gjta1, d5gjta2, d5gjtb_, d5gjtl2
   automated match to d1dn0a1
   complexed with nag

Details for d5gjtl1

PDB Entry: 5gjt, 3.1 Å

PDB Description: crystal structure of h1 hemagglutinin from a/washington/05/2011 in complex with a neutralizing antibody 3e1

PDB Compounds: (L:) light chain of human neutralizing antibody 3E1

SCOPe Domain Sequences for d5gjtl1:

Sequence; same for both SEQRES and ATOM records:

>d5gjtl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspatlsasvgdrvsitcrasqsisswlawyqqkpgkapklliykasslesgvps
rfsgsgsgseftltisslqpddfaiyycqqynsypwtfgqgtkvei

Timeline for d5gjtl1:

• d5gjtl1 first appeared in SCOPe 2.06
  
• d5gjtl1 appears in the current release, SCOPe 2.08