SCOPe 2.08: Domain d5k8ya1: 5k8y A:194-327

Lineage for d5k8ya1 (5k8y A:194-327)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries)

8. Domain d5k8ya1: 5k8y A:194-327 [326983]
   Other proteins in same PDB: d5k8ya2, d5k8yb2
   automated match to d3c22d_
   complexed with ca, gol, p6g

Details for d5k8ya1

PDB Entry: 5k8y, 2.4 Å

PDB Description: structure of the mus musclus langerin carbohydrate recognition domain

PDB Compounds: (A:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d5k8ya1:

Sequence; same for both SEQRES and ATOM records:

>d5k8ya1 d.169.1.0 (A:194-327) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ilemvargwkyfsgnfyyfsrtpktwysaeqfcisrkahltsvsseseqkflykaadgip
hwigltkagsegdwywvdqtsfnkeqsrrfwipgepnnagnnehcanirvsalkcwndgp
cdntflfickrpyv

Timeline for d5k8ya1:

• d5k8ya1 first appeared in SCOPe 2.06
  
• d5k8ya1 appears in SCOPe 2.07