![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
![]() | Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) ![]() Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
![]() | Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (5 proteins) |
![]() | Protein CDC25a [52823] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52824] (1 PDB entry) |
![]() | Domain d1c25a_: 1c25 A: [32698] |
PDB Entry: 1c25 (more details), 2.3 Å
SCOPe Domain Sequences for d1c25a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} mligdfskgylfhtvagkhqdlkyispeimasvlngkfanlikefviidcrypyeyeggh ikgavnlhmeeevedfllkkpivptdgkrvivvfhcefssergprmcryvrerdrlgney pklhypelyvlkggykeffmkcqsyceppsyrpmhhedfke
Timeline for d1c25a_: