Lineage for d1c25__ (1c25 -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24082Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
  4. 24083Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (2 families) (S)
  5. 24084Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (2 proteins)
  6. 24085Protein CDC25a [52823] (1 species)
  7. 24086Species Human (Homo sapiens) [TaxId:9606] [52824] (1 PDB entry)
  8. 24087Domain d1c25__: 1c25 - [32698]

Details for d1c25__

PDB Entry: 1c25 (more details), 2.3 Å

PDB Description: human cdc25a catalytic domain

SCOP Domain Sequences for d1c25__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c25__ c.46.1.1 (-) CDC25a {Human (Homo sapiens)}
mligdfskgylfhtvagkhqdlkyispeimasvlngkfanlikefviidcrypyeyeggh
ikgavnlhmeeevedfllkkpivptdgkrvivvfhcefssergprmcryvrerdrlgney
pklhypelyvlkggykeffmkcqsyceppsyrpmhhedfke

SCOP Domain Coordinates for d1c25__:

Click to download the PDB-style file with coordinates for d1c25__.
(The format of our PDB-style files is described here.)

Timeline for d1c25__: