SCOPe 2.08: Domain d1c25a_: 1c25 A:

Lineage for d1c25a_ (1c25 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (5 proteins)

6. Protein CDC25a [52823] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52824] (1 PDB entry)

8. Domain d1c25a_: 1c25 A: [32698]

Details for d1c25a_

PDB Entry: 1c25, 2.3 Å

PDB Description: human cdc25a catalytic domain

PDB Compounds: (A:) cdc25a

SCOPe Domain Sequences for d1c25a_:

Sequence; same for both SEQRES and ATOM records:

>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]}
mligdfskgylfhtvagkhqdlkyispeimasvlngkfanlikefviidcrypyeyeggh
ikgavnlhmeeevedfllkkpivptdgkrvivvfhcefssergprmcryvrerdrlgney
pklhypelyvlkggykeffmkcqsyceppsyrpmhhedfke

Timeline for d1c25a_:

• d1c25a_ first appeared (with stable ids) in SCOP 1.55, called d1c25__
  
• d1c25a_ appears in SCOPe 2.07