| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
| Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
| Protein automated matches [190459] (61 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:470] [324884] (3 PDB entries) |
| Domain d5h7xe1: 5h7x E:1-163 [326974] Other proteins in same PDB: d5h7xe2, d5h7xf2 automated match to d3f3ma_ complexed with cit |
PDB Entry: 5h7x (more details), 1.76 Å
SCOPe Domain Sequences for d5h7xe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h7xe1 c.26.1.0 (E:1-163) automated matches {Acinetobacter baumannii [TaxId: 470]}
msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
Timeline for d5h7xe1: