Lineage for d5ji3b_ (5ji3 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2229891Species Escherichia coli [TaxId:562] [326970] (1 PDB entry)
  8. 2229893Domain d5ji3b_: 5ji3 B: [326972]
    Other proteins in same PDB: d5ji3e_
    automated match to d1e94a_
    complexed with dat

Details for d5ji3b_

PDB Entry: 5ji3 (more details), 3 Å

PDB Description: hsluv complex
PDB Compounds: (B:) ATP-dependent protease subunit HslV

SCOPe Domain Sequences for d5ji3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ji3b_ d.153.1.4 (B:) automated matches {Escherichia coli [TaxId: 562]}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

SCOPe Domain Coordinates for d5ji3b_:

Click to download the PDB-style file with coordinates for d5ji3b_.
(The format of our PDB-style files is described here.)

Timeline for d5ji3b_: