Lineage for d1d5ra2 (1d5r A:14-187)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483040Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2483041Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2483042Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 2483061Protein Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain [52818] (1 species)
  7. 2483062Species Human (Homo sapiens) [TaxId:9606] [52819] (1 PDB entry)
  8. 2483063Domain d1d5ra2: 1d5r A:14-187 [32697]
    Other proteins in same PDB: d1d5ra1
    complexed with tla

Details for d1d5ra2

PDB Entry: 1d5r (more details), 2.1 Å

PDB Description: crystal structure of the pten tumor suppressor
PDB Compounds: (A:) phosphoinositide phosphatase pten

SCOPe Domain Sequences for d1d5ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rryqedgfdldltyiypniiamgfpaerlegvyrnniddvvrfldskhknhykiynlcae
rhydtakfncrvaqypfedhnppqlelikpfcedldqwlseddnhvaaihckagkgrtgv
micayllhrgkflkaqealdfygevrtrdkkgvtipsqrryvyyysyllknhld

SCOPe Domain Coordinates for d1d5ra2:

Click to download the PDB-style file with coordinates for d1d5ra2.
(The format of our PDB-style files is described here.)

Timeline for d1d5ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d5ra1