Lineage for d1d5ra2 (1d5r A:14-187)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123051Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
  4. 123052Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) (S)
  5. 123053Family c.45.1.1: Dual specificity phosphatase-like [52800] (5 proteins)
  6. 123070Protein Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain [52818] (1 species)
  7. 123071Species Human (Homo sapiens) [TaxId:9606] [52819] (1 PDB entry)
  8. 123072Domain d1d5ra2: 1d5r A:14-187 [32697]
    Other proteins in same PDB: d1d5ra1

Details for d1d5ra2

PDB Entry: 1d5r (more details), 2.1 Å

PDB Description: crystal structure of the pten tumor suppressor

SCOP Domain Sequences for d1d5ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens)}
rryqedgfdldltyiypniiamgfpaerlegvyrnniddvvrfldskhknhykiynlcae
rhydtakfncrvaqypfedhnppqlelikpfcedldqwlseddnhvaaihckagkgrtgv
micayllhrgkflkaqealdfygevrtrdkkgvtipsqrryvyyysyllknhld

SCOP Domain Coordinates for d1d5ra2:

Click to download the PDB-style file with coordinates for d1d5ra2.
(The format of our PDB-style files is described here.)

Timeline for d1d5ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d5ra1